PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 339aa    MW: 39486.9 Da    PI: 5.2516
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041435genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-173279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++++G g+W+  a++ g++Rt+k+c++rw++yl
      Lus10041435 32 RGPWTLEEDTLLSHYIARHGEGRWNMLAKCAGLKRTGKSCRLRWLNYL 79
                     89********************************************97 PP

2Myb_DNA-binding506.9e-1685128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+ E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10041435  85 RGNLTPKEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 128
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.442779IPR017930Myb domain
SuperFamilySSF466893.41E-3030126IPR009057Homeodomain-like
SMARTSM007171.2E-143181IPR001005SANT/Myb domain
PfamPF002491.2E-153279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-223386IPR009057Homeodomain-like
CDDcd001674.92E-113479No hitNo description
PROSITE patternPS0017504756IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.39580134IPR017930Myb domain
SMARTSM007171.4E-1484132IPR001005SANT/Myb domain
PfamPF002497.0E-1585128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2387133IPR009057Homeodomain-like
CDDcd001671.04E-1089128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MQTLRAPFMN LQAHGGNHEE ESSDQNHSEV RRGPWTLEED TLLSHYIARH GEGRWNMLAK  60
CAGLKRTGKS CRLRWLNYLK PDIKRGNLTP KEQLLILELH SKWGNRWSRI AQHLPGRTDN  120
EIKNYWRTRV QRQARQLHIE SNSKLFLDAV RCYWVPRLLQ KVEQQINYPP QQQQEIESHH  180
RITKVVAPDD SAASQEVVIP SSYEQVEETN LSNSASITVL STDSTTISYY QQPPPENVME  240
SELIGFPVEY SYYNNNNNNS SSNMMMQNYD YGMDGFDDAM APPLMYHDNE INNPSQYPEI  300
MSAVSEQEWQ MGDNSYYDSL WNLDDTWQYR GMREEMGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24321337107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082112.11e-107PREDICTED: transcription factor MYB108
TrEMBLA0A067JZX51e-107A0A067JZX5_JATCU; MYB family protein
STRINGPOPTR_0008s12130.16e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-83myb domain protein 62